PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0324s0021.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family EIL
Protein Properties Length: 607aa    MW: 66440.4 Da    PI: 6.2727
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0324s0021.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3356.55e-109129249318
                          XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STT CS
                 EIN3  49 msraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslse 138
                          msraQDgiLkYMlk +evcna+GfvYgiip+kgkpv+gasd+Lr+WWke v+fd+n +aa+ ky+a++l++++ + + + + ++  +l++
  Kalax.0324s0021.2.p   1 MSRAQDGILKYMLKLVEVCNARGFVYGIIPDKGKPVSGASDNLRGWWKETVKFDKNSTAALDKYEAECLAMGKLNAN-V-NGNSRGMLQD 88 
                          9*********************************************************************9976666.4.89999***** PP

                          S-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTT CS
                 EIN3 139 lqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirele 228
                          lqD+tlgSLLs+l+qhcdppqr++plekg++pPWWPtG+e+ww +lgl+++q+ ppy+kphdlkk+wkv+vLtavikhmsp+i++i++l 
  Kalax.0324s0021.2.p  89 LQDATLGSLLSSLIQHCDPPQRKYPLEKGIPPPWWPTGEEDWWVKLGLPASQS-PPYRKPHDLKKMWKVGVLTAVIKHMSPDITKIKRLI 177
                          ****************************************************9.9*********************************** PP

                          TTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX..XX.XXXXXXXXXXXXXXXXXXXX.............XXXXXX.XXXXXXXXXX CS
                 EIN3 229 rqskylqdkmsakesfallsvlnqeekecatvsah..ss.slrkqspkvtlsceqkedve.............gkkeskikhvqavktta 302
                          +qsk+lqdkm+ake+ ++l+vl++ee+++    ++  s  s   qs + ++ +e++ dv              g           +++t 
  Kalax.0324s0021.2.p 178 LQSKCLQDKMTAKETTIWLAVLSHEESLISLTITSdlSDvSGDGQSGNRQVATENNHDVSitdvevasglpkkG----------RKNQTV 257
                          ***************************99765555453354445787888888888888865644444432221..........222222 PP

                          ...................XXXXXXXXXXXXXXXX CS
                 EIN3 303 ...................gfpvvrkrkkkpsesa 318
                                             g +v ++ kk+ps+++
  Kalax.0324s0021.2.p 258 dsvvesqlhvestrnpirvGKQVKNRGKKQPSKRN 292
                          34444445556666666663333333333344333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048731.8E-1061203No hitNo description
Gene3DG3DSA:1.10.3180.105.7E-6879207IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167682.88E-5985205IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042762Biological Processregulation of sulfur metabolic process
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 607 aa     Download sequence    Send to blast
MSRAQDGILK YMLKLVEVCN ARGFVYGIIP DKGKPVSGAS DNLRGWWKET VKFDKNSTAA  60
LDKYEAECLA MGKLNANVNG NSRGMLQDLQ DATLGSLLSS LIQHCDPPQR KYPLEKGIPP  120
PWWPTGEEDW WVKLGLPASQ SPPYRKPHDL KKMWKVGVLT AVIKHMSPDI TKIKRLILQS  180
KCLQDKMTAK ETTIWLAVLS HEESLISLTI TSDLSDVSGD GQSGNRQVAT ENNHDVSITD  240
VEVASGLPKK GRKNQTVDSV VESQLHVEST RNPIRVGKQV KNRGKKQPSK RNPVIQDGTP  300
QSSDNLPVEE VRSAPLNQLT DSVGDRPPHN DGHSVSAGYE VNAAEKNRKR RRVSHDPVAR  360
GPGLQSKNSF VAEDVLSVSA DKNHVEASSF EIQAHYTSHQ NKQPVILQQS QENDLGAQPY  420
RVLPATNLSP AQSMYLGWLP LPSSVPHPAA NNCGTEHQMY NASGNYGTNY IQSSGTAAYE  480
HAQNGLQDAV IQPQILQDQP AGLAVRVDSN PYVVGTFHNG ARKEVAEGYL NPDALGNDNS  540
QILVTGGGLN PCVQGTLDSN QDMPFEGLDF SFNDMPMDFE GFNSPLSLND LDFFLNDSDM  600
LEHMAS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wij_A7e-718520611132ETHYLENE-INSENSITIVE3-like 3 protein
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1347351RKRRR
2348352KRRRV
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00233DAPTransfer from AT1G73730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011037881.11e-134PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBLB9GMA11e-132B9GMA1_POPTR; ETHYLENE-INSENSITIVE3-like 3 family protein
STRINGPOPTR_0001s05360.11e-131(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.11e-117ETHYLENE-INSENSITIVE3-like 3